Wiktionary:General Service List

Definition from Wiktionary, the free dictionary
Jump to: navigation, search

This list has 2284 words in it. It was originally created to be a list of useful words, with frequency as one factor. It was created by Michael West in 1954 in thse work A General Service List of English Words, which is now believed to be in the public domain, as US copyright law at the time required that copyrights be renewed, and this was not done.

The list is here presented in frequency order.

Sections[edit]

1-200 201-400 401-600 601-800 801-1000 1001-1200 1201-1400 1401-1600 1601-1800 1801-2000 2001-2200 2201-2284

List[edit]

1-200[edit]

thebeofandatoinhehaveitthatfortheyIwithasnotonsheatbythisweyoudobutfromorwhichonewouldallwilltheresaywhomakewhencanmoreifnomanoutothersowhattimeupgoaboutthanintocouldstateonlynewyearsometakecometheseknowseeusegetlikethenfirstanyworknowmaysuchgiveoverthinkmostevenfinddayalsoafterwaymanymustlookbeforegreatbackthroughlongwheremuchshouldwellpeopledownownjustbecausegoodeachthosefeelseemhowhightooplacelittleworldverystillnationhandoldlifetellwritebecomehereshowhousebothbetweenneedmeancalldevelopunderlastrightmovethinggeneralschoolneversameanotherbeginwhilenumberpartturnrealleavemightwantpointformoffchildfewsmallsinceagainstasklatehomeinterestlargepersonendopenpublicfollowduringpresentwithoutagainholdgovernaroundpossibleheadconsiderwordprogramproblemhoweverleadsystemsetordereyeplanrunkeepfacefactgroupplaystandincreaseearlycoursechangehelpline

201-400[edit]

cityputclosecaseforcemeetoncewateruponwarbuildhearlightuniteliveeverycountrybringcenterletsidetryprovidecontinuenamecertainpowerpayresultquestionstudywomanmemberuntilfarnightalwaysserviceawayreportsomethingcompanyweekchurchtowardstartsocialroomfigurenaturethoughyounglessenoughalmostreadincludepresidentnothingyetbetterbigboycostbusinessvaluesecondwhyclearexpectfamilycompleteactsensemindexperienceartnextneardirectcarlawindustryimportantgirlgodseveralmatterusualratherperoftenkindamongwhitereasonactionreturnfootcaresimplewithinlovehumanalongappeardoctorbelievespeakactivestudentmonthdriveconcernbestdoorhopeexampleinformbodyeverleastprobableunderstandreacheffectdifferentideawholecontrolconditionfieldpassfallnotespecialtalkparticulartodaymeasurewalkteachlowhourtypecarryrateremainfullstreeteasyalthoughrecordsitdeterminelevellocalsurereceivethusmomentspirittraincollegereligionperhapsmusicgrowfreecauseserveagebookboardrecentsoundofficecutstepclasstruehistorypositionabovestrongfriendnecessaryaddcourtdealtaxsupportpartywhethereitherlandmaterialhappeneducationdeath

401-600[edit]

agreearmmotheracrossquiteanythingtownpastviewsocietymanageanswerbreakorganizehalffirelosemoneystopactualalreadyeffortwaitdepartmentablepoliticallearnvoiceairtogethershallcovercommonsubjectdrawshortwifetreatlimitroadlettercolorbehindproducesendtermtotaluniversityrisecenturysuccessminuterememberpurposetestfightwatchsituationsouthagodifferencestagefathertablerestbearentiremarketprepareexplainofferplantchargegroundwestpicturehardfrontliemoderndarksurfaceruleregarddancepeaceobservefuturewallfarmclaimfirmoperationfurtherpressurepropertymorningamounttopoutsidepiecesometimesbeautytradefeardemandwonderlistacceptjudgepaintmilesoonresponsibleallowsecretaryheartunionslowislandenterdrinkstoryexperimentstaypaperspaceapplydecidesharedesirespendsignthereforevariousvisitsupplyofficerdoubtprivateimmediatewishcontainfeedraisedescribereadyhorsesonexistnorthsuggeststationeffectivefooddeepwidealonecharacterenglishhappycriticunitproductrespectdropnorfillcoldrepresentsuddenbasickillfinetroublemarksinglepressheavyattemptoriginstandardeverythingcommitteemoralblackredbadearthaccordelsemeredieremarkbasisexceptequaleasteventemploy

601-800[edit]

defensesmileriverimprovegamedetailaccountcentsortreduceclubbuyattentionshipdecisionwearinsidewinsupposerideoperaterealizesalechooseparksquarevotepricedistrictdeadforeignwindowbeyonddirectionstrikeinsteadtrialpracticecatchopportunitylikelyrecognizepermitseriousattackfloorassociationspringlotstocklackhairsciencerelationprofessionpatternquickmedicalinfluenceoccasionmachinecomparehusbandblueinternationalfairespeciallyindeedimaginesurpriseaverageofficialtemperaturedifficultsinghittreeracepolicetouchrelativethrowqualityformerpullchanceprovearguesettlegrowthdateheatsaveperformancecountproductionlistenmainpicksizecoolarmypatientcombinesummerhallslightcommandenjoylengthproperexpresshealthchiefeveningstorelanguagedegreelaycurrentgundoghotelstrangeseparateboatfailcleandressanyonegainpainobjectknowledgedependrelatebelowdollaradvanceshapearrangepopulationyessellmentiondrycheckpoetsleepjoinhotbedelectricdreamdueseasonmannerfitleftprogressneitherstrengthnoticefinishopinionbillwesterntruthwrongtravelsuitbankexacthonorbrotherquietmarrycornerhandledangerhospitalpoolpromisebloodshootsceneliteraturearrivefilmbasefreedombarmaybehangsuffermanufacturefrequentrocklossburn

801-1000[edit]

sunaudienceessentialglasspreventpoempoorinchsongskillpostpopularradioanimalconsciouswortheatelectionfaithwavemurdermodelforgetextendedgedistancememoryrecommenddivisionstafflegdiscussionaddressflydependentballshakeframeextremeengineerthickcomfortlattercampoildiscoverexaminedifficultytoothmiddlechoicereferenemypracticalmarriagebridgedeclareladycrossdailyafternoonattenddirectorbalancewashcapitalspeedblockcitizenmouthhillgreenpleasemotoragencyencouragegovernorworryaffairshoulderbrightmasssampleprettyrepeatrollpushtripcouncilclotheparentforwardsharpstraightgasweightdiscussfixloadmasterwhateverroundrapidlaughfingerspotproposeshopbroadreplacereplyextentlockemployeeaheadsightspreadwindapprovedestroynonepoundfameimportancereflectadvantagematchregularwagerefuseexistencehardlyperformtitletendexercisethincoatbitmountainyouthbehaviornewspapersecretabilityseasoftjusticereasonablecirclesolidpageweaponfastrepresentativesearchpureescapecrowdsticktelephoneavoidgardenfavornewsunlessdinnersomeonesignalyardidealwarmmisssheltersoldierarticlecrycaptainfamiliarseatguestweakexcitekingeveryonewineholedutybeatperfectbottomcomposebattleexpensecattleflowkitchendustbottleadmit

1001-1200[edit]

teartireexpressionexceptionapplicationbelongrichfailurestruggleinstrumentvarietynarrowtheatercollectionrainreviewpreserveleadershipclaydaughterfellowswingthanklibraryfatreservetournicewarnringbitterchairyesterdayscientificflowerwheelsolutionaimgatherinvitemoreoverfreshforestwinterboxbeliefordinaryimpossibleprintgraytastelipspeechreferencestainconnectionotherwisestretchknifevillageblowmistakesweetshoutdivideguardworseexchangerarecommercialrequestappointagentdependencebirdwildmotionguessneighborseedfashionloancorrectplainmailretireoppositeprefersafeevildoublewoodemptybabyadvisecontentsportliftliterarycurioustieflatmessageneckhatedirtdelighttrustnobodyvalleytoolpresencecookrailroadministercoffeebrushbesidecollectguideluckprofitlordeverybodyprisoncloudslavechairmansoildistinguishintroduceurgeblindariseuppercurvemembershipkeyentertainsoulneighborhoodfriendlypairstoneleanprotectadvertisemysterywelcomekneejumpsnakestreamavenuebrowndiseasehatexcellentformalsnowsheetsomehowunityskyroughsmoothweathersteadythreatendepthopposedeliverancientprayadoptbirthappearanceuniversebusyhurrycoastforthsmellfurnishfemalehidewireproposaloughtvictoryquarterenginecustomerwastefoolintendintentiondeskpoliticspassage

1201-1400[edit]

lawyerrootclimbmetalgradualhuntprotectionsatisfyroofbranchpleasurewitnessloosenoseminebandasiderisktomorrowremindearfishshoreoperatorcivilizebeingsilentscreenbindearnpackcolonybesidesslipcousinscalereliefexplorestembrainmusiciandefendbendsomebodyshadowmixsmokedescriptionfruitguiltyieldsensitivesaltpalesweepcompletionthroatagricultureadmiregentledozenparticlepleasantbaycupcompetitionmoonterriblestripmechanicshockconversationangletallplentystaryellowsickthoroughabsolutesucceedsurroundprouddearcardlakebreathafraidsilenceontoshoesomewherechainslidecopymachinerywakeseverepocketbonehonestfreezedictionarycalmswimicemaleskincrackrushwetmeatcommercejointgifthostsuspectpathuncleaffordinstantsatisfactoryheighttrackconfidencegrasssuggestionfavoritebreakfastapartchestentrancemarchsinknorthernironaliveillbagdisturbnativebedroomviolentbeneathpausetoughsubstancethreatcharmabsencefactoryspitemealuniversalaccidenthighwaysentencelibertywisenoisediscoverytubeflashtwistfencechildhoodjoysistersadefficiencydisappeardefeatextensiverentcomparisonpossessgracefleshliquidscientisteaseheavenmilksympathyrankrestaurantfrequencyangryshadeaccusenecessityknockloudpermanentrowlovelyconfusegoldfrightensolve

1401-1600[edit]

gravesalaryphotographadviceabroadwoundvirtuedarequeenextraattractnumerouspinkgateexpensiveshutchickenforgiveholywoodenpromptcrimesorryrepublicangervisitorpileviolencesteelwingstairpartnerdelaygentlemanpourconfusiondamagekicksafetyburstnetworkresistancescrewpridetillhireverbpreachclerkeverywhereanywayfanconnecteggefficientgraincalculatedragoppositionworshiparrestdisciplinestringharborcameramechanismcowgrandfunnyinsurancereductionstrictlessontightsandplatequalifyelsewheremadinterferencepupilfoldroyalvaluablewhisperanybodyhurtexcessquantityfunmudextensionrecognitionkisscropsailattractivehabitrelievewisdompersuadecertaintyclotheagerdeservesympatheticcuretrappuzzlepowderrawmankindgladblamewheneveranxietybustremblesacredfortunateglorygoldenneatweekendtreasuryovercomecatsacrificecomplainelectroarsaketempleselfcompetenursestuffstomachpeculiarrepairstormtondesertallowanceservanthungerconsciencebreadcrashtipstrengthenproofgeneroussirtonightwhiptonguemillmerchantcoalruinintroductioncourageactorbeltstirpackagepunishreflectionbreatheanywhereamusedullfatenetfellowshipfaultfurniturebeampencilborderdisappointflamejokeblesscornshelltemptsupperdestructiondiveanxiousshinecheapdishdistantgreetfloodexcuseinsect

1601-1800[edit]

oceanceremonydecreaseprizeharminsureversepotsincerecottonleafrubmedicinestrokebitelunglonelyadmissionstupidscratchcompositionbroadcastdrumresistneglectabsentpassengeradventurebegpipebeardboldmeanwhiledevilcheernutsplitmeltswearsugarburywipefaintcreaturetailwealthearnesttranslatesuspicionnobleinquiryjourneyhesitateextraordinaryborrowowefuneralambitionmixtureslopecriminalseldommapspinpraisespareplowtelegraphbarrelstraightenscarcelunchslaverycreepsweatgaystiffbraveseizeconvenienthorizonmoderatecomplicatedigcurseweighpriestexcessivequarrelwidowmodestdinepoliticiancustomeducatesalesmannailtapeasternpossessionsatisfactionbehavemercyscatterobjectionsilvertentsaddlewrapnestgrindspellplasterarchswellfriendshipbathbundlegratefulcrownboundarynowhereasleepclockboilaltogetherlendholidaypreciouswanderuglyreputationticketpretenddismissdelicatedespairawaketeafalsefortunecapthreadhastebareshirtbargainleatherrailbutterdotinquirewarmthdecisivevesselpitysteampinboundcompaniontoerewardforbidwherevertowerbathelodgeswallowmultiplybowkingdomgaragepermissionpumppreventionurgentauntzeroidlefeverChristmasregretjawsoappronounceempirebowloutlineorganimitationcautionmineraldisagreebladetricktreasureimmenseconveniencedisapprovedestructive

1801-2000[edit]

forknoonownershiptunepolishpoisonshameloyaltycottageastonishshavefeathersauceliddebtfadeconfessclassificationdescendcapemildcleverenvelopeinventionsheepsplendidstampfloatbrickricebusinessmanbackwardqualificationartificialattractionlampcurlshowerelderbunchbellsteerflavorspitrobcreaminterruptpenweaveorangerescuecrushhumblefancydecaypolitetribebleedcoinfondautumnclassifyomitloyalneedlelessencomplaintpadsteepskirtcurtaincalculationlaughtersolemngreaseinterfereexplodefastenflagresignpostponepatienceboastropeenvyairplaneridshieldveilkneeltrayexplosivebrasstaxiwaxduckbuttoninventremedybushthunderweakenpovertyscrapearrowtendercruelsoftenmousehayanyhowalikecircularjuiceshelfbakehatredcautiousbasketwreckwidthconfidentlogheapsuckladdergapobeyhutaxetranslationcollardeliveryreproduceconfessionpanprejudicevoyagetobaccosimplicitypastecakeelephantribbonharvestashamedcavecustomarythiefdampsewrustseparationwaiterpetstrawupsettowelrefreshessencefurambitiousdefendantdaylightdipsuspiciousimaginaryashcarriageeducatorsawstoverubberrugmiseryawkwardrivalroastdeedpreferenceexplosiontheatricalcultivatecollectormiserablewristrabbitaccustomtideinsultthumblumpannoytoyhealshallowrepetitionsoupwhistlescenery

2001-2200[edit]

appleoffensecorkripetempersorepinchdiamondrazorimaginativehookcopperlandlordinfluentialrothollowenclosehardenwickedstiffensilkuprightselfishstripepiginwardexcellencerakepurplehastenshortenapplauseacheapologyknotnephewcushiondrownnurserypintfierceimitatealoudgaietyrobberytightenperfectionscornwhoevertrunkwoolsailorcompetitormoonlightdeerbeaneverydaydrawerdisregardnowadayspatriotictinpennycagepardonlatelyoffendcoarsespoilhorizontalstingditchlibrarianmeantimecoughdeafswordmessengervaincastleelasticcombrodwidensorrowinventorcliffumbrellainterruptionmerrygallonconquestheadachetailorbucketscentsignaturecartdarkensometimeapplaudunderneathhellopretensedescentconquerframeworkconfidentialadoptiondisgustwaistmomentaryreceiptpearlraylazylimbgrammaticalbeastmonkeyjewelpersuasionobediencesockvowelhammerinnchimneydissatisfactionannoyanceornamenthonestyoutwardsharpenhandkerchiefgreedheavenlythirstniecespillloafwheatwormsecrecyrudeheightenflattenloosencheeserivalryroyaltydiscontentcomplicationfrightindoorflouractresscongratulationouncefryeverlastinggoatinkdisappearancereproductionthickenavoidancespoonstrapdeceivelengthenrevengecorrectiondescendanthesitationspadebasinweedomissionold-fashionedbicyclebreadthphotographycowardmatrejoicecheatcongratulatediscomfortenclosureattentivepawoverflowdissatisfymultiplicationwhichevertidybribemendstocking

2201-2284[edit]

feastnuisancethorntameinclusivehomemadehandwritingchalksourslipperyprocessionripenjealousjealousyliarhomecomingbarberwhitenberrylightenpigeonhinderbraverybaggagenounamongstgrammarcultivationcompanionshiprubbishmodestywoolendeepenpastrycupboardquartcanalnotebookdeceitparcelbrightenmoderationpunctualhurrahlipstickuppermostfattenconquerorhindrancecowardiceobedientsaucermaddenscoldweekdayrottendisrespectwidowerdeafendonkeybusinesslikemotherhoodsaddenhandshakecalculatorheaddressscissorstranslatorpossessorshillingreddenmotherlywhosecultivatorwhomhomeworkelectricianoarbriberysweetensowpronunciationbeakplural